Mouse Anti-Marmoset BTF3 Antibody (MO-AB-51991W)


Cat: MO-AB-51991W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO51991W
SpecificityThis antibody binds to Marmoset BTF3.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Product OverviewMouse Anti-Marmoset BTF3 (clone MO51991W) Antibody (MO-AB-51991W) is a mouse antibody against BTF3. It can be used for BTF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor BTF3 isoform A; LOC100411014; BTF3
UniProt IDF6WAJ8
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MRRTGAPAQADSRGRGRARGGCPGGEATLSLPPPPGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEEDDDEVPDLVENFDEASKNEAN.
For Research Use Only | Not For Clinical Use.

Online Inquiry