Mouse Anti-Frog c1r Antibody (MO-AB-01970H)


Cat: MO-AB-01970H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO01970C
SpecificityThis antibody binds to Frog c1r.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1R (Complement C1r) is a Protein Coding gene. Diseases associated with C1R include Ehlers-Danlos Syndrome, Periodontal Type, 1 and Periodontal Ehlers-Danlos Syndrome. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include calcium ion binding and serine-type peptidase activity. An important paralog of this gene is MASP2.
Product OverviewThis product is a mouse antibody against c1r. It can be used for c1r detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC84776 protein; c1r; MGC84776
UniProt IDQ6GLK4
Protein RefseqThe length of the protein is 476 amino acids long.
The sequence is show below: MWHYLVLLLGAVVCSQNSNNSPLSGTITSPNYPKLYPNFNESTWDINVPEGYHVSLNFSVFDIEPSENCSCGFVKVMADGKELGHFCGPMNSSAHPGNRQFVSQGNQMTIHFQSNFSEEMDGGIIPYKGFQAFYQAIVVICEDPPVLTNGQYKFLTAPGNLEYKSVIQYQCNSPYYYMVTPNGSDTFSCSAQRDWRDEHGGDKIPRCRPVCGKPENPVTSFGRILHGKKAEPGNFPWQVYVSRYGTAGGALIGEQWVLTAAQVLPDNVEKQDLNDVLVYMGSLNMKNLMEMDTYPVEAFYMHPNFNRNNYDNDIALIRLKNPVVMNQNVSPICLPSPEDEDDIYQKDRVGYVSGYGKTENHKVANELHYVSVPVASRQACKTYLNKKRPAIRYPSDEDKYLFSRNMFCAGFPEGSLNKGDSCSGDSGGAYTSQNRQDTWVATGLVSWGFSCGQGYGFYTKVSNYVDWIKSYVGEDA.
For Research Use Only | Not For Clinical Use.
Online Inquiry