Mouse Anti-Zebrafish c1r Antibody (CBMOAB-68285FYA)


Cat: CBMOAB-68285FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO68285FYA
SpecificityThis antibody binds to Zebrafish c1r.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionC1R (Complement C1r) is a Protein Coding gene. Diseases associated with C1R include Ehlers-Danlos Syndrome, Periodontal Type, 1 and Periodontal Ehlers-Danlos Syndrome. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include calcium ion binding and serine-type peptidase activity. An important paralog of this gene is MASP2.
Product OverviewMouse Anti-Zebrafish c1r Antibody is a mouse antibody against c1r. It can be used for c1r detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:112309; c1
UniProt IDQ4V9I1
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MDGIHLIICLLWACVNVCECDLAMFGEVSSPQYPDPYPADLQKQWDLEVPQGFQIQLTFNHLDIEPSPNCYYDSVSVVSDRKVLGKFCGQNSTDKFHPSDKPILAPGNRLQLLFLTDDSNHESHLGFSAFYQAVDTDECSSSSVGIDPPCSQICLNTLGSFLCACQLGLKKLLQIINIHCASKNIIQISFYEECK.
For Research Use Only | Not For Clinical Use.
Online Inquiry