Mouse Anti-Frog cox1 Antibody (MO-AB-02586H)


Cat: MO-AB-02586H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02586C
SpecificityThis antibody binds to Frog cox1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of COX2 and heme A of COX1 to the active site in COX1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix (Probable). COX1 is a catalytic core subunit containing heme A and the active site BNC with heme A3 and the copper atom CU(B) (PubMed:30598554).
Product OverviewThis product is a mouse antibody against cox1. It can be used for cox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclooxygenase 1; cox1
UniProt IDB7ZRV2
Protein RefseqThe length of the protein is 587 amino acids long.
The sequence is show below: MAGLCLTMLFMIVTSSYSLEVSTKVNPCCYYPCQHKGVCVRFEMEEYQCDCTRTGYYGTNCTIPEWWTKFRELIRPSPAFYHYILTRFKWFWDIINSTFIRDFIVRLVLTVRSNLIPSPPTYNSEYGYISWEAYSNVSYFTRVLPPVPHDCPTPMGTKGKKELPDATFLVETFLKREKFIPDPQGTNLLFAFFAQHFTHQFFKTYGRMGRGFIKGFGHGVDLSHIYGDSLERQHILRLFKDGKLKYQIINGETYPPTVVEAPVHMIYPENVPKEKQFAVGQEVFGLLPGLMMYATLWLREHNRVCDVLKKEHPTWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYYLKLKFDPELLFGVQFQYRNRIAVEFNQLYHWHPLMPEKFKIIEDEFGYSSFIYNTSIILDYGVEALVESFTKQIAGKIGGGKNHPPSLLKVAAGVIEESRNLRLQPFNEYRKRFGLKAYKSFRDLTGEEKMAAQLEEFYGDIDALEFYVGLLLEKPNPNSIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGETGFNIVKTASIQKLVCLNVKTCPFVAFHVPDVLPTLKKSDEL.
See other products for " COX1 "
MO-AB-11039YMouse Anti-O. mykiss COX1 Antibody (MO-AB-11039Y)
MO-DKB-02053WRabbit Anti-COX1 Antibody (MO-DKB-02053W)
MO-DKB-02677WRabbit Anti-COX1 Antibody (MO-DKB-02677W)
CBMOAB-26448FYCMouse Anti-Arabidopsis COX1 Antibody (CBMOAB-26448FYC)
MO-AB-69503WMouse Anti-Silkworm COX1 Antibody (MO-AB-69503W)
MO-AB-53444WMouse Anti-Marmoset COX1 Antibody (MO-AB-53444W)
CBMOAB-22313FYBMouse Anti-Rice cox1 Antibody (CBMOAB-22313FYB)
MO-AB-24797RMouse Anti-Pig COX1 Antibody (MO-AB-24797R)
MO-AB-23095HMouse Anti-Mallard COX1 Antibody (MO-AB-23095H)
MO-AB-08392WMouse Anti-Cat COX1 Antibody (MO-AB-08392W)
For Research Use Only | Not For Clinical Use.
Online Inquiry