Mouse Anti-Frog derl1 Antibody (MO-AB-02955H)


Cat: MO-AB-02955H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02955C
SpecificityThis antibody binds to Frog derl1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the derlin family. Members of this family participate in the ER-associated degradation response and retrotranslocate misfolded or unfolded proteins from the ER lumen to the cytosol for proteasomal degradation. This protein recognizes substrate in the ER and works in a complex to retrotranslocate it across the ER membrane into the cytosol. This protein may select cystic fibrosis transmembrane conductance regulator protein (CFTR) for degradation as well as unfolded proteins in Alzheimer's disease. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Product OverviewThis product is a mouse antibody against derl1. It can be used for derl1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC84200 protein; derl1; MGC84200
UniProt IDQ6DJH4
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MSDLGDWFRSIPLITRYWFAASIAVPLFGKLGLINAVNLILWPENFLHKFQIWRPLTATFYFPVGPKTGFLYLVNLYFLYQYSSRLETGAFDGRPADYVFMLLFNWICIVITGVIINMQLLMIPLIMSVLYVWSQLNRDMIVSFWFGTRFKACYLPWVILGFNFIISGSVVDELIGNLVGHLYYFLMFKYPMDLGGRNFLTTPQFLYRWLPSRRGGGGVSGFGIPPASARRVEEEQPGAGRRHDWGQGFRLGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry