Mouse Anti-Frog gpx1 Antibody (MO-AB-04043H)
Cat: MO-AB-04043H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Frog (Xenopus laevis) |
Clone | MO04043C |
Specificity | This antibody binds to Frog gpx1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Other studies indicate that H2O2 is also essential for growth-factor mediated signal transduction, mitochondrial function, and maintenance of thiol redox-balance; therefore, by limiting H2O2 accumulation, glutathione peroxidases are also involved in modulating these processes. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is the most abundant, is ubiquitously expressed and localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. It is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. This gene contains an in-frame GCG trinucleotide repeat in the coding region, and three alleles with 4, 5 or 6 repeats have been found in the human population. The allele with 4 GCG repeats has been significantly associated with breast cancer risk in premenopausal women. Alternatively spliced transcript variants have been found for this gene. Pseudogenes of this locus have been identified on chromosomes X and 21. |
Product Overview | This product is a mouse antibody against gpx1. It can be used for gpx1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glutathione peroxidase; MGC114747 |
UniProt ID | Q58E16 |
Protein Refseq | The length of the protein is 143 amino acids long. The sequence is show below: MSRLQDMYGSRGLQVLAFPCNQFGHQENSGNQEILNILQHVRPGGDFKPNFPLFEKVDVNGEKEHPLFTFLKQQLPYPSDDSLSLMQDPKSIIWSPVRRNDIAWNFEKFLITKNGVPYKRYGRRFETFNIQQDIEKLLDEKCA. |
See other products for " GPX1 "
MO-DKB-01996W | Rabbit Anti-GPX1 Antibody (MO-DKB-01996W) |
CBMOAB-01572CR | Mouse Anti-Yeast GPX1 Antibody (CBMOAB-01572CR) |
MO-AB-08785W | Mouse Anti-Cat GPX1 Antibody (MO-AB-08785W) |
MO-AB-26099H | Mouse Anti-Rat Gpx1 Antibody (MO-AB-26099H) |
MO-AB-34857W | Mouse Anti-Ferret GPX1 Antibody (MO-AB-34857W) |
MO-AB-00625R | Mouse Anti-Medaka gpx1 Antibody (MO-AB-00625R) |
CBMOAB-34188FYC | Mouse Anti-Arabidopsis GPX1 Antibody (CBMOAB-34188FYC) |
MO-AB-02214Y | Mouse Anti-Chicken GPX1 Antibody (MO-AB-02214Y) |
MO-AB-14469W | Mouse Anti-Chimpanzee GPX1 Antibody (MO-AB-14469W) |
MO-AB-00579L | Mouse Anti-Elephant GPX1 Antibody (MO-AB-00579L) |
For Research Use Only | Not For Clinical Use.
Online Inquiry