Mouse Anti-Frog snapin Antibody (MO-AB-07869H)


Cat: MO-AB-07869H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07869C
SpecificityThis antibody binds to Frog snapin.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against snapin. It can be used for snapin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC496040 protein; snapin; LOC496040
UniProt IDQ5PPY9
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MAVSPGRDVFAEGLLELLKPAVQQLDSHVHAVRESQVDLREHIDNLASELCKINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGSHHPPASPNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry