Mouse Anti-Zebrafish snapin Antibody (CBMOAB-06665FYB)


Cat: CBMOAB-06665FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO06665FYB
SpecificityThis antibody binds to Zebrafish snapin.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a coiled-coil-forming protein that associates with the SNARE (soluble N-ethylmaleimide-sensitive fusion protein attachment protein receptor) complex of proteins and the BLOC-1 (biogenesis of lysosome-related organelles) complex. Biochemical studies have identified additional binding partners. As part of the SNARE complex, it is required for vesicle docking and fusion and regulates neurotransmitter release. The BLOC-1 complex is required for the biogenesis of specialized organelles such as melanosomes and platelet dense granules. Mutations in gene products that form the BLOC-1 complex have been identified in mouse strains that are models of Hermansky-Pudlak syndrome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish snapin Antibody is a mouse antibody against snapin. It can be used for snapin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:dkey-222b8.2 protein; snapin; si:dkey-222b8.
UniProt IDQ1L8R9
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MAALAVVETPSGKDALAEGLLDLLRPAVQQLDLHVHSVRESQVELREHIDNLASELCRINEHQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHNVAKETARRKTMLEASGAFTPRSPSKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry