Mouse Anti-Frog tspo Antibody (MO-AB-08790H)


Cat: MO-AB-08790H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO08790C
SpecificityThis antibody binds to Frog tspo.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
Product OverviewThis product is a mouse antibody against tspo. It can be used for tspo detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBzrp-prov protein; tspo
UniProt IDQ8AVD5
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MTSWAPAIGLSLLPHVGGIVGGLITRKEVKTWYTTLVKPSWRPPNWMFGPVWTTLYTSMGYGSYLIYKELGGLNEKAVVPLGLYAGQLALNWAWTPIFFGAHKIGWGLVDLVFLWGTAVATTLSWHPISRSAAYLMLPYLAWLTLASALNYCIWRDNKKEDKSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry