Mouse Anti-Pig TSPO Antibody (MO-AB-31021R)


Cat: MO-AB-31021R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO31021R
SpecificityThis antibody binds to Pig TSPO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein.
Product OverviewThis product is a mouse antibody against TSPO. It can be used for TSPO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranslocator protein; TSPO
UniProt IDF1SJR8
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MAPPWVPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGLAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry