Mouse Anti-Fruit fly BAG2 Antibody (MO-AB-02257W)


Cat: MO-AB-02257W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02257W
SpecificityThis antibody binds to Fruit fly BAG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner.
Product OverviewMouse Anti-Fruit fly BAG2 Antibody is a mouse antibody against BAG2. It can be used for BAG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG7945, isoform B; RE70822p; BAG2
UniProt IDQ9VUQ1
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MFENFRGIFRKRRRCESDTTPPPPPPQPAQEAEIINRYPEDIEADTPESNDGFDASWTEGSFHSPHSDRPFNASERFVTILDSLDARVEKLRKDALNLQEKKDYLLMSMDLIKSNEMMQNMSEAEREEIILYLQRVSSRLATVELRVRTVRDNSQEDSLSQINVLIDSMIKMGDPVIGRQRCQFYLNACCSSSMDPSGHMDTVPEADVGPVDKKFESVLLGCTLDDQKNIKKRLQALMAYLNKQTVSH.
For Research Use Only | Not For Clinical Use.
Online Inquiry