Mouse Anti-Pig BAG2 Antibody (MO-AB-24061R)
Cat: MO-AB-24061R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO24061R |
Specificity | This antibody binds to Pig BAG2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. |
Product Overview | This product is a mouse antibody against BAG2. It can be used for BAG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BCL2-associated athanogene 2, Fragment; BAG2 |
UniProt ID | F2VR55 |
Protein Refseq | The length of the protein is 62 amino acids long. The sequence is show below: ETIRNPQQQESLKQATRIIDEVVSKFLDDLGNAKSHLMSLYSACSSEVPAGPVDQKFQSIVI. |
See other products for " BAG2 "
MO-AB-13137W | Mouse Anti-Chimpanzee BAG2 Antibody (MO-AB-13137W) |
MO-AB-51716W | Mouse Anti-Marmoset BAG2 Antibody (MO-AB-51716W) |
MO-AB-02257W | Mouse Anti-Fruit fly BAG2 Antibody (MO-AB-02257W) |
CBMOAB-25038FYC | Mouse Anti-Arabidopsis BAG2 Antibody (CBMOAB-25038FYC) |
CBMOAB-67379FYA | Mouse Anti-Zebrafish bag2 Antibody (CBMOAB-67379FYA) |
MO-AB-24315H | Mouse Anti-Rat Bag2 Antibody (MO-AB-24315H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry