Rabbit Anti-FRZB (N-terminal) Antibody (Cat MO-DKB-03448W)
Cat: MO-DKB-03448W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Specificity | This antibody is binds to Human sFRP-3/FRZB and has cross reactivity with Mouse, Rat, Cattle, Horse, Guinea pig, Rabbit, Zebrafish sFRP-3/FRZB. |
| Immunogen | The immunogen of this antibody against a synthetic peptide at the N-terminus of human FRZB is FRZB. Peptide sequence HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC. The peptide sequence of the immunogen was taken from the region. |
| Epitope | N-terminal |
| Format | Liquid or Lyophilized |
| Buffer | PBS, 2% Sucrose |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purification | Affinity purified |
Application Information
| Application | WB |
| Application Notes | Western Blot: 1.0 ug/mL The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. |
| Product Overview | This product is a Rabbit antibody against the sFRP-3/FRZB. It can be used for sFRP-3/FRZB detection in Western Blot. |
| Alternative Names | Frizzled-related protein; Fzb-1; frzb; fzb |
| UniProt ID | Q9W6E0 |
See other products for " FRZB "
| MO-AB-12705R | Mouse Anti-Cattle FRZB Antibody (MO-AB-12705R) |
| MO-AB-01943Y | Mouse Anti-Chicken FRZB Antibody (MO-AB-01943Y) |
| CBMOAB-76994FYA | Mouse Anti-Zebrafish frzb Antibody (CBMOAB-76994FYA) |
| MO-AB-25909R | Mouse Anti-Pig FRZB Antibody (MO-AB-25909R) |
| MO-AB-44796W | Mouse Anti-Horse FRZB Antibody (MO-AB-44796W) |
| MO-AB-25917W | Mouse Anti-Chimpanzee FRZB Antibody (MO-AB-25917W) |
| MO-AB-03701H | Mouse Anti-Frog frzb Antibody (MO-AB-03701H) |
| MO-AB-55674W | Mouse Anti-Marmoset FRZB Antibody (MO-AB-55674W) |
| MO-AB-25889H | Mouse Anti-Rat Frzb Antibody (MO-AB-25889H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry