Mouse Anti-Horse FRZB Antibody (MO-AB-44796W)
Cat: MO-AB-44796W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO44796W |
Specificity | This antibody binds to Horse FRZB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. |
Product Overview | Mouse Anti-Horse FRZB Antibody is a mouse antibody against FRZB. It can be used for FRZB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Frizzled-related protein; FRZB |
UniProt ID | Q09HD3 |
Protein Refseq | The length of the protein is75 amino acids long. The sequence is show below: MVCGSLGGMLLLRAGLLALAXLCPLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIEQFEGL. |
See other products for " FRZB "
MO-AB-12705R | Mouse Anti-Cattle FRZB Antibody (MO-AB-12705R) |
MO-AB-55674W | Mouse Anti-Marmoset FRZB Antibody (MO-AB-55674W) |
CBMOAB-76994FYA | Mouse Anti-Zebrafish frzb Antibody (CBMOAB-76994FYA) |
MO-AB-03701H | Mouse Anti-Frog frzb Antibody (MO-AB-03701H) |
MO-AB-25889H | Mouse Anti-Rat Frzb Antibody (MO-AB-25889H) |
MO-AB-25917W | Mouse Anti-Chimpanzee FRZB Antibody (MO-AB-25917W) |
MO-AB-01943Y | Mouse Anti-Chicken FRZB Antibody (MO-AB-01943Y) |
MO-DKB-03448W | Rabbit Anti-FRZB (N-terminal) Antibody (Cat MO-DKB-03448W) |
MO-AB-25909R | Mouse Anti-Pig FRZB Antibody (MO-AB-25909R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry