AibGenesis™ Mouse Anti-FUOM Antibody (CBMOAB-43212FYA)


Cat: CBMOAB-43212FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43212FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO43212FYA 100 µg
CBMOAB-77250FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77250FYA 100 µg
MO-AB-12748R Monoclonal Cattle (Bos taurus) WB, ELISA MO12748R 100 µg
MO-AB-25904H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25904C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO43212FYA
SpecificityThis antibody binds to Rhesus FUOM.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FUOM Antibody is a mouse antibody against FUOM. It can be used for FUOM detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFUOM
UniProt IDF7HIM6
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPLEIRADGLGIPPLLEALLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILHRAGCTRALAKLERFEFYERAKKAFAVVATGGWRKVSAPWPCRPA.
For Research Use Only | Not For Clinical Use.
Online Inquiry