AibGenesis™ Mouse Anti-GAL3ST4 Antibody (CBMOAB-43316FYA)


Cat: CBMOAB-43316FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43316FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO43316FYA 100 µg
MO-AB-12849R Monoclonal Cattle (Bos taurus) WB, ELISA MO12849R 100 µg
MO-AB-18105W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18105W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO43316FYA
SpecificityThis antibody binds to Rhesus GAL3ST4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the galactose-3-O-sulfotransferase protein family. The product of this gene catalyzes sulfonation by transferring a sulfate to the C-3' position of galactose residues in O-linked glycoproteins. This enzyme is highly specific for core 1 structures, with asialofetuin, Gal-beta-1,3-GalNAc and Gal-beta-1,3 (GlcNAc-beta-1,6)GalNAc being good substrates. (From NCBI)
Product OverviewMouse Anti-Rhesus GAL3ST4 Antibody is a mouse antibody against GAL3ST4. It can be used for GAL3ST4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGAL3ST4
UniProt IDF7DJT1
Protein RefseqThe length of the protein is 424 amino acids long.
The sequence is show below: MTPRSATGAFRGCTAFSSCLCPCSWPWLHPSLISPFPVPHGPSVSCQDAAALGTSEPRGGSGSLHDHWLCTPALGRALPEEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRAFYRPGARGDHYARNLLWFDFGLPFPPEKRAKRGNLHPPRDPDPRQLQVLPSGAGPRAQTLNPNALIHPVSTVADHRSQISSPASFDLGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGRKQDLSTFSNTGLTAEDQQLTARARAWNNLDWALYVHFNRSLWARIEKYGQRRLQTAVAELRARREALAKHCLAGGEASDPKYITDHRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP.
For Research Use Only | Not For Clinical Use.
Online Inquiry