AibGenesis™ Mouse Anti-GAPC1 Antibody (CBMOAB-22784FYB)


Cat: CBMOAB-22784FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22784FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Soybean (Glycine max) WB, ELISA MO22784FYB 100 µg
CBMOAB-33700FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO33700FC 100 µg
MO-AB-31549H Monoclonal Soybean (Glycine max) WB, ELISA MO31549C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Soybean (Glycine max)
CloneMO22784FYB
SpecificityThis antibody binds to Rice GAPC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionKey enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Essential for the maintenance of cellular ATP levels and carbohydrate metabolism. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice GAPC1 Antibody is a mouse antibody against GAPC1. It can be used for GAPC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlyceraldehyde-3-phosphate dehydrogenase 1, cytosolic; EC 1.2.1.12; PP38; GAPC1; GAPC GAPDH GPC; Os08g0126300 LOC_Os08g03290
UniProt IDQ0J8A4
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry