Mouse Anti-GDI2 Antibody (MO-AB-44851W)
Cat: MO-AB-44851W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-44851W | Monoclonal | Horse (Equus caballus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO44851W | 100 µg | ||
| CBMOAB-43497FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43497FYA | 100 µg | ||
| CBMOAB-77745FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77745FYA | 100 µg | ||
| MO-AB-20750W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20750W | 100 µg | ||
| MO-AB-30923W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30923W | 100 µg | ||
| MO-AB-12960R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12960R | 100 µg | ||
| MO-AB-26056R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26056R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO44851W |
| Specificity | This antibody binds to Horse GDI2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Horse GDI2 Antibody is a mouse antibody against GDI2. It can be used for GDI2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Rab GDP dissociation inhibitor beta-like protein; GDI2 |
| UniProt ID | L7MTB0 |
| Protein Refseq | The length of the protein is285 amino acids long. The sequence is show below: IDPKKTAMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKDIYKRMTGSEFDFEEMKRKKNDIYGED. |
See other products for " GDI2 "
| MO-AB-55935W | Mouse Anti-GDI2 Antibody (MO-AB-55935W) |
| CBMOAB-33922FYC | Mouse Anti-GDI2 Antibody (CBMOAB-33922FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry