Mouse Anti-GDI2 Antibody (MO-AB-55935W)


Cat: MO-AB-55935W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-55935W Monoclonal Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO55935W 100 µg
CBMOAB-43497FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43497FYA 100 µg
CBMOAB-77745FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77745FYA 100 µg
MO-AB-20750W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20750W 100 µg
MO-AB-30923W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30923W 100 µg
MO-AB-12960R Monoclonal Cattle (Bos taurus) WB, ELISA MO12960R 100 µg
MO-AB-26056R Monoclonal Pig (Sus scrofa) WB, ELISA MO26056R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO55935W
SpecificityThis antibody binds to Marmoset GDI2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Marmoset GDI2 Antibody is a mouse antibody against GDI2. It can be used for GDI2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRab GDP dissociation inhibitor beta isoform 1; GDI2
UniProt IDF6QGU6
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPMKTTMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFISISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED.
See other products for " GDI2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry