Mouse Anti-GDI2 Antibody (MO-AB-55935W)
Cat: MO-AB-55935W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-55935W | Monoclonal | Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO55935W | 100 µg | ||
| CBMOAB-43497FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43497FYA | 100 µg | ||
| CBMOAB-77745FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77745FYA | 100 µg | ||
| MO-AB-20750W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20750W | 100 µg | ||
| MO-AB-30923W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30923W | 100 µg | ||
| MO-AB-12960R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12960R | 100 µg | ||
| MO-AB-26056R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26056R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Marmoset, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO55935W |
| Specificity | This antibody binds to Marmoset GDI2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
| Product Overview | Mouse Anti-Marmoset GDI2 Antibody is a mouse antibody against GDI2. It can be used for GDI2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Rab GDP dissociation inhibitor beta isoform 1; GDI2 |
| UniProt ID | F6QGU6 |
| Protein Refseq | The length of the protein is 445 amino acids long. The sequence is show below: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPMKTTMREVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFISISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED. |
See other products for " GDI2 "
| CBMOAB-33922FYC | Mouse Anti-GDI2 Antibody (CBMOAB-33922FYC) |
| MO-AB-44851W | Mouse Anti-GDI2 Antibody (MO-AB-44851W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry