Mouse Anti-gdpd2 Antibody (CBMOAB-77750FYA)


Cat: CBMOAB-77750FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-77750FYA Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO77750FYA 100 µg
CBMOAB-43506FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43506FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO77750FYA
SpecificityThis antibody binds to Zebrafish gdpd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycerophosphodiester phosphodiesterase enzyme family. The encoded protein hydrolyzes glycerophosphoinositol to produce inositol 1-phosphate and glycerol. This protein may have a role in osteoblast differentiation and growth. Alternate splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish gdpd2 Antibody is a mouse antibody against gdpd2. It can be used for gdpd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesgdpd2; si:dkey-31j3.9; Glycerophosphodiester Phosphodiesterase Domain Containing 2
UniProt IDE7FGP0
Protein RefseqThe length of the protein is 514 amino acids long.
The sequence is show below: MITMFRTCLRGIYSCHWNQRSNEQKSDRCWLSFLSFVSILALSWMYICFIAFNDHYDVNNELFKAVKKWVNWYMIVMIISAVLAIYCLLLLVFGLLHLAIKEPLNLHCLHKVFLFLGLLAVTLETAGFCFKWEKQWKAIYMSFQATAPFLQLSAVVALTVISCLVFQSYHRAKTTACKIFIMMTFLVVSAAVFLCPLAICSPCITSNLPPKPALIGHRGAPMLAPENTLMSFRKSLEFGVVAFETDVQLSKDKKPFLMHDCGKNFLLRTTDVKDKFPGRDGSNNFTLQELKTLNAGKWFSRSDPFWTLSSLSEEERREADNQTVPSLSELLDLVKKHNVSLIFDLKNENNSTVFQSSDSFYTTETINKLGISPDKIWWLPPEYRHDVMKMEPGFKQVYNKQKEMLMDGGNFMNMNFSSLSALEISELRKSNVSVNLWVVNERWLFSLLWCSGVSSVTTNACHLFKDMSKPDWHLEPNMYKGIWIATDIVSLLLMIGLFLWQRRRLTGDWSTGIY.
For Research Use Only | Not For Clinical Use.
Online Inquiry