Mouse Anti-GDPD2 Antibody (MO-AB-12962R)


Cat: MO-AB-12962R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12962R Monoclonal Cattle (Bos taurus), Rhesus (Macaca mulatta) WB, ELISA MO12962R 100 µg
CBMOAB-43506FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43506FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rhesus (Macaca mulatta)
CloneMO12962R
SpecificityThis antibody binds to Cattle GDPD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGDPD2 (Glycerophosphodiester Phosphodiesterase Domain Containing 2) is a Protein Coding gene. Diseases associated with GDPD2 include Epidermolysis Bullosa, Junctional, Non-Herlitz Type. Gene Ontology (GO) annotations related to this gene include phosphoric diester hydrolase activity and glycerophosphoinositol inositolphosphodiesterase activity. An important paralog of this gene is GDPD5.
Product OverviewMouse Anti-Cattle GDPD2 Antibody is a mouse antibody against GDPD2. It can be used for GDPD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycerophosphodiester phosphodiesterase domain containing 2; GDPD2
UniProt IDQ3SZL1
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MAESPGCCSVWARCFHCLYSCHWKKCPRDRMQTNKCECVWFGLLFLTFLLSLGWLYVVLILLNDLHNFNEFLFQRWGHWMDWSPAFLLVISLLVTYASLLLLLALLLWLYGQPLCLHTVHKVLLLLIIFLVAAGLVGLEVQWQEEWHSLRLSLQATAPFLHIGAAAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry