AibGenesis™ Mouse Anti-Gem2 Antibody (CBMOAB-17337FYA)


Cat: CBMOAB-17337FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17337FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster WB, ELISA MO17337FYA 100 µg
MOFAB-719W Monoclonal D. melanogaster WB, IHC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster
CloneMO17337FYA
SpecificityThis antibody binds to fruit fly Gem2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the survival motor neuron (SMN) complex that catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Gem2 Antibody is a mouse antibody against Gem2. It can be used for Gem2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Gemin2; Gem2
UniProt IDQ9VVX0
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MQHEPEDQTFQLQALEICEPDSSFDPQKPPESGEEYLMHMFYERKRCPAVVTKRSSKIRNNTGNTTLEMLDNPELPPFKCLLPTPEWRDEQVKSFQAARSQVLVLRKELANNNYDQSGEPPLTSDQEKWKEFCRNQQPLLSTLLHLTQNDLELLLEMLSKWLQDPNTTVDLLHDVWLARWLYATLVCLHLPLEPHVFSTLRYIARTCIHLRNQLKEDEVQRAAPYNLLLTLTVQVFAQNDFKDYI.
For Research Use Only | Not For Clinical Use.
Online Inquiry