AibGenesis™ Mouse Anti-GID4 Antibody (CBMOAB-43584FYA)


Cat: CBMOAB-43584FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43584FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO43584FYA 100 µg
MO-AB-14476W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14476W 100 µg
MO-AB-26000H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26000C 100 µg
MO-AB-55992W Monoclonal Marmoset WB, ELISA MO55992W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO43584FYA
SpecificityThis antibody binds to Rhesus GID4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. (From NCBI)
Product OverviewMouse Anti-Rhesus GID4 Antibody is a mouse antibody against GID4. It can be used for GID4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGID4
UniProt IDF6TKJ7
Protein RefseqThe length of the protein is 300 amino acids long.
The sequence is show below: MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLVRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPPALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR.
For Research Use Only | Not For Clinical Use.
Online Inquiry