AibGenesis™ Mouse Anti-GIMAP6 Antibody (CBMOAB-60082FYC)


Cat: CBMOAB-60082FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60082FYC Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO60082FYC 100 µg
Inquiry
MO-AB-13056R Monoclonal Cattle (Bos taurus) WB, ELISA MO13056R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO60082FYC
SpecificityThis antibody binds to Rhesus GIMAP6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the GTPases of immunity-associated proteins (GIMAP) family. GIMAP proteins contain GTP-binding and coiled-coil motifs, and may play roles in the regulation of cell survival. Decreased expression of this gene may play a role in non-small cell lung cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, which is found in a cluster with seven additional GIMAP genes on the long arm of chromosome 7. (From NCBI)
Product OverviewMouse Anti-Rhesus GIMAP6 Antibody is a mouse antibody against GIMAP6. It can be used for GIMAP6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTPase IMAP family member 6 isoform 1; GIMAP6
UniProt IDH9FDS4
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: DECEHMPQESPREELSQDPVLELSGGLREKEQKTPRRLRLILVGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry