AibGenesis™ Mouse Anti-GLRA4 Antibody (MO-AB-13115R)


Cat: MO-AB-13115R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13115R Monoclonal Cattle (Bos taurus), Marmoset WB, ELISA MO13115R 100 µg
MO-AB-56067W Monoclonal Marmoset WB, ELISA MO56067W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset
CloneMO13115R
SpecificityThis antibody binds to Cattle GLRA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which has a neurotransmitter-gated ion-channel ligand binding domain. The encoded protein is very similar to a mouse protein which is a subunit of the retinal glycine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Cattle GLRA4 Antibody is a mouse antibody against GLRA4. It can be used for GLRA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC139528 protein; MGC139528
UniProt IDA5PJQ4
Protein RefseqThe length of the protein is 342 amino acids long.
The sequence is show below: MTTLVPATLSFLLLWTLPGQVLLRVALAKEEVKPGTKASQPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPMDIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHYNTGKFTCIEVKFHLERQM.
For Research Use Only | Not For Clinical Use.
Online Inquiry