AibGenesis™ Mouse Anti-GLT8D2 Antibody (CBMOAB-43697FYA)


Cat: CBMOAB-43697FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43697FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO43697FYA 100 µg
CBMOAB-78052FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78052FYA 100 µg
MO-AB-12622W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12622W 100 µg
MO-AB-13126R Monoclonal Cattle (Bos taurus) WB, ELISA MO13126R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO43697FYA
SpecificityThis antibody binds to Rhesus GLT8D2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GLT8D2 Antibody is a mouse antibody against GLT8D2. It can be used for GLT8D2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycosyltransferase 8 domain-containing protein 2; GLT8D2
UniProt IDH9F8Z5
Protein RefseqThe length of the protein is 284 amino acids long.
The sequence is show below: MAAINSIYSNTDANILFYVVGLRNTLTRIRKWIEHSKLREINFKIVEFNPMVLKGKIRPDSSRPELLQPLNFVRFYLPLLIHQHEKVIYLDDDVIVQGDIQELYDTTLALGHAAAFSDDCDLPSAQDINRLVGLQNTYMGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQHITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLHWNGRHKPWDFPSVHNDLWESWFVPDPAGIFKLNHHS.
For Research Use Only | Not For Clinical Use.
Online Inquiry