AibGenesis™ Mouse Anti-GLTSCR1 Antibody (CBMOAB-43705FYA)


Cat: CBMOAB-43705FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43705FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO43705FYA 100 µg
CBMOAB-78059FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78059FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO43705FYA
SpecificityThis antibody binds to Rhesus GLTSCR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GLTSCR1 Antibody is a mouse antibody against GLTSCR1. It can be used for GLTSCR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlioma tumor suppressor candidate region gene 1 protein; GLTSCR1
UniProt IDH9FKR8
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: PLAVAPGLGSSPLVPAPNVILHRTPTPIQPKPAGVLPPKLYQLTPKPFAPAGATLTIQGEPGALPQQPKAPQNLTFMAAGKAGQNVVLSGFPAPALQANVFKQPPATTTGAAPPQPPGALSKPMSVHLLNQGSSIVIPAQHMLPGQNQFLLPGAPAVQLPQQLSALPANVGGQILAAAAPHTGGQLIANPILT.
For Research Use Only | Not For Clinical Use.
Online Inquiry