Mouse Anti-Goat AIF1 Antibody (MO-AB-36679W)


Cat: MO-AB-36679W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO36679W
SpecificityThis antibody binds to Goat AIF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
Product OverviewMouse Anti-Goat AIF1 Antibody is a mouse antibody against AIF1. It can be used for AIF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIonized calcium binding adapter molecule 1; AIF1
UniProt IDG1DFQ7
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MSETRDLQGGKAFGLLKAQQEERINEINQQFLDDPKYSSDEDLPSKLEACKKKYMEFDLNEDGDIMSLKRMMEKLGVPETHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAKEQEKPTGLPAKKAISELP.
For Research Use Only | Not For Clinical Use.
Online Inquiry