Mouse Anti-Rhesus AIF1 Antibody (MO-NAB-00221W)
Cat: MO-NAB-00221W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Human (Homo sapiens), Pig (Sus scrofa), Rhesus (Macaca mulatta) |
| Clone | NW0009 |
| Immunogen | This AIF-1 / Iba1 antibody (2A2-B6) was developed against the full-length recombinant protein of AIF-1 / Iba1 (AAH09474.1, 1 a.a.~147 a.a) with GST tag. The MW of only the GST tag is 26 KDa. MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKVILMYEEKAREKEKPTGPPAKKAISELP. |
| Format | Liquid or Lyophilized |
| Buffer | PBS, pH 7.4 |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | IgG purified |
Application Information
| Application | WB, ELISA, S-ELISA |
| Application Notes | WB: 1/500 |
Target
| Introduction | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
| Product Overview | Mouse Anti-Rhesus AIF1 (clone NW0009) Antibody (MO-NAB-00221W) is a Mouse antibody against the epitope of the AIF-1/Iba1. It can be used for AIF-1/Iba1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay, S-Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Allograft Inflammatory Factor 1; Ionized Calcium-Binding Adapter Molecule 1; Interferon Gamma Responsive Transcript; Protein G1; AIF-1; IBA1; IRT-1; IRT1; G1 |
| Gene ID | 199 |
| UniProt ID | P55008 |
See other products for " AIF1 "
| MO-AB-36679W | Mouse Anti-Goat AIF1 Antibody (MO-AB-36679W) |
| MO-AB-06273Y | Mouse Anti-O. anatinus Aif1 Antibody (MO-AB-06273Y) |
| MO-DKB-00589W | Rabbit Anti-AIF1 Antibody (MO-DKB-00589W) |
| MO-AB-23648R | Mouse Anti-Pig AIF1 Antibody (MO-AB-23648R) |
| MO-DKB-00881W | Goat Anti-AIF1 Antibody (MO-DKB-00881W) |
| MO-AB-07162R | Mouse Anti-Cattle AIF1 Antibody (MO-AB-07162R) |
| CBMOAB-00169CR | Mouse Anti-Yeast AIF1 Antibody (CBMOAB-00169CR) |
| MO-DKB-00595W | Rabbit Anti-AIF1 Antibody (MO-DKB-00595W) |
| MOFY-0622-FY116 | Rabbit Anti-AIF1 Antibody (MOFY-0622-FY116) |
| CBMOAB-35373FYA | Mouse Anti-Rhesus AIF1 Antibody (CBMOAB-35373FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry