Mouse Anti-Goat ALB Antibody (MO-AB-36684W)


Cat: MO-AB-36684W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO36684W
SpecificityThis antibody binds to Goat ALB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the most abundant protein in human blood. This protein functions in the regulation of blood plasma colloid osmotic pressure and acts as a carrier protein for a wide range of endogenous molecules including hormones, fatty acids, and metabolites, as well as exogenous drugs. Additionally, this protein exhibits an esterase-like activity with broad substrate specificity. The encoded preproprotein is proteolytically processed to generate the mature protein. A peptide derived from this protein, EPI-X4, is an endogenous inhibitor of the CXCR4 chemokine receptor.
Product OverviewMouse Anti-Goat ALB Antibody is a mouse antibody against ALB. It can be used for ALB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerum albumins; ALB
UniProt IDP85295
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: DTHKSEIAHRFNDLGRHPEYAVSVLLRHLVDEPQNLIKKHGEYGFQNALIVRXXXKAPQVSTPTLVEISRKQTALVELLKLVASTQAALA.
For Research Use Only | Not For Clinical Use.
Online Inquiry