Mouse Anti-Goat ALB Antibody (MO-AB-36684W)
Cat: MO-AB-36684W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Goat (Capra hircus) |
Clone | MO36684W |
Specificity | This antibody binds to Goat ALB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the most abundant protein in human blood. This protein functions in the regulation of blood plasma colloid osmotic pressure and acts as a carrier protein for a wide range of endogenous molecules including hormones, fatty acids, and metabolites, as well as exogenous drugs. Additionally, this protein exhibits an esterase-like activity with broad substrate specificity. The encoded preproprotein is proteolytically processed to generate the mature protein. A peptide derived from this protein, EPI-X4, is an endogenous inhibitor of the CXCR4 chemokine receptor. |
Product Overview | Mouse Anti-Goat ALB Antibody is a mouse antibody against ALB. It can be used for ALB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serum albumins; ALB |
UniProt ID | P85295 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: DTHKSEIAHRFNDLGRHPEYAVSVLLRHLVDEPQNLIKKHGEYGFQNALIVRXXXKAPQVSTPTLVEISRKQTALVELLKLVASTQAALA. |
See other products for " ALB "
MO-AB-28912W | Mouse Anti-Dog ALB Antibody (MO-AB-28912W) |
MOFY-0622-FY221 | Rabbit Anti-ALB Antibody (MOFY-0622-FY221) |
MO-AB-07213R | Mouse Anti-Cattle ALB Antibody (MO-AB-07213R) |
MO-AB-22833H | Mouse Anti-Mallard alb Antibody (MO-AB-22833H) |
MOFY-0722-FY396 | Biotin conjugated antibody to ALB Antibody (MOFY-0722-FY396) |
MO-AB-43625W | Mouse Anti-Horse ALB Antibody (MO-AB-43625W) |
MO-DKB-00598W | Rabbit Anti-ALB Antibody (MO-DKB-00598W) |
MOFY-0722-FY371 | FITC conjugated antibody to ALB Antibody (MOFY-0722-FY371) |
MO-AB-70619W | Mouse Anti-Cattle ALB Antibody (MO-AB-70619W) |
MO-AB-07154Y | Mouse Anti-Rabbit ALB Antibody (MO-AB-07154Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry