Mouse Anti-Goat HPS1 Antibody (MO-AB-37428W)
Cat: MO-AB-37428W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Goat (Capra hircus) |
Clone | MO37428W |
Specificity | This antibody binds to Goat HPS1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on chromosome 22. |
Product Overview | Mouse Anti-Goat HPS1 Antibody is a mouse antibody against HPS1. It can be used for HPS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Hermansky-Pudlak syndrome 1 protein; HPS1 |
UniProt ID | B4XH77 |
Protein Refseq | The length of the protein is 38 amino acids long. The sequence is show below: KCVLVATEGAEVLFYWTDAEFEESLRLKFGQTENEGEK. |
See other products for " HPS1 "
MO-AB-13790R | Mouse Anti-Cattle HPS1 Antibody (MO-AB-13790R) |
MO-AB-56940W | Mouse Anti-Marmoset HPS1 Antibody (MO-AB-56940W) |
CBMOAB-20717FYA | Mouse Anti-D. melanogaster Hps1 Antibody (CBMOAB-20717FYA) |
MO-AB-26377R | Mouse Anti-Pig HPS1 Antibody (MO-AB-26377R) |
MO-AB-26372H | Mouse Anti-Rat Hps1 Antibody (MO-AB-26372H) |
MO-AB-19021W | Mouse Anti-Chimpanzee HPS1 Antibody (MO-AB-19021W) |
CBMOAB-44792FYA | Mouse Anti-Rhesus HPS1 Antibody (CBMOAB-44792FYA) |
CBMOAB-79924FYA | Mouse Anti-Zebrafish hps1 Antibody (CBMOAB-79924FYA) |
CBMOAB-60270FYC | Mouse Anti-Rhesus HPS1 Antibody (CBMOAB-60270FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry