Mouse Anti-Goat HPS1 Antibody (MO-AB-37428W)


Cat: MO-AB-37428W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO37428W
SpecificityThis antibody binds to Goat HPS1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on chromosome 22.
Product OverviewMouse Anti-Goat HPS1 Antibody is a mouse antibody against HPS1. It can be used for HPS1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHermansky-Pudlak syndrome 1 protein; HPS1
UniProt IDB4XH77
Protein RefseqThe length of the protein is 38 amino acids long.
The sequence is show below: KCVLVATEGAEVLFYWTDAEFEESLRLKFGQTENEGEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry