Mouse Anti-Rat Hps1 Antibody (MO-AB-26372H)


Cat: MO-AB-26372H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO26372C
SpecificityThis antibody binds to Rat Hps1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is a component of three different protein complexes termed biogenesis of lysosome-related organelles complex (BLOC)-3, BLOC4, and BLOC5. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 1. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on chromosome 22.
Product OverviewThis product is a mouse antibody against Hps1. It can be used for Hps1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHermansky-Pudlak syndrome 1 homolog (Human), isoform CRA_b; Hermansky-Pudlak syndrome protein variant; Hps; Hps1
UniProt IDQ99MK6
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MRCVLVATEGAEVLFYWTDEEFEENLRQKFRQSENEEEEIVACLSMLLRMPSKGRRDGSAVRALTTLPEVSRSREFNSQHPHGGSQPSVMGSDALFWCV.
For Research Use Only | Not For Clinical Use.
Online Inquiry