Mouse Anti-Goat MOS Antibody (MO-AB-37689W)


Cat: MO-AB-37689W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO37689W
SpecificityThis antibody binds to Goat MOS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).
Product OverviewMouse Anti-Goat MOS Antibody is a mouse antibody against MOS. It can be used for MOS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-mos Moloney murine sarcoma viral oncogene-like protein; MOS
UniProt IDH9TU39
Protein RefseqThe length of the protein is 91 amino acids long.
The sequence is show below: LERCLKYSLDVVSGLLFLHGQSIVHLDLKPANILISEQDVCKIGDFGCSVRLEDLRSPWTPHHLGGTYTHRAPELLKGEPVTPKADIYSFA.
See other products for " MOS "
CBMOAB-51589FYAMouse Anti-Rhesus MOS Antibody (CBMOAB-51589FYA)
MOFY-0922-FY463Mouse Anti-Mos Antibody, IgG2a kappa (MOFY-0922-FY463)
CBMOAB-87220FYAMouse Anti-Zebrafish mos Antibody (CBMOAB-87220FYA)
CBMOAB-24496FYAMouse Anti-D. melanogaster Mos Antibody (CBMOAB-24496FYA)
MOFY-0922-FY462Mouse Anti-Mos Antibody, IgG2b kappa (MOFY-0922-FY462)
For Research Use Only | Not For Clinical Use.
Online Inquiry