Mouse Anti-Goat SDHB Antibody (MO-AB-38160W)
Cat: MO-AB-38160W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Goat (Capra hircus) |
Clone | MO38160W |
Specificity | This antibody binds to Goat SDHB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. |
Product Overview | Mouse Anti-Goat SDHB Antibody is a mouse antibody against SDHB. It can be used for SDHB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mitochondrial succinate dehydrogenase [ubiquinone] iron-sulfur subunit; SDHB |
UniProt ID | I1Z736 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: CCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKQASA. |
See other products for " SDHB "
MO-AB-63992W | Mouse Anti-Marmoset SDHB Antibody (MO-AB-63992W) |
CBMOAB-2550YC | Mouse Anti-E. coli sdhB Antibody (CBMOAB-2550YC) |
MO-AB-28658W | Mouse Anti-Cucumber sdhB Antibody (MO-AB-28658W) |
MO-AB-19859R | Mouse Anti-Cattle SDHB Antibody (MO-AB-19859R) |
MO-AB-09866Y | Mouse Anti-Rabbit SDHB Antibody (MO-AB-09866Y) |
MO-AB-46485W | Mouse Anti-Horse SDHB Antibody (MO-AB-46485W) |
MO-AB-23708H | Mouse Anti-Mallard SDHB Antibody (MO-AB-23708H) |
MO-AB-33758H | Mouse Anti-Nile tilapia SDHB Antibody (MO-AB-33758H) |
MO-AB-07765W | Mouse Anti-Cat SDHB Antibody (MO-AB-07765W) |
MO-AB-42535W | Mouse Anti-Guinea pig SDHB Antibody (MO-AB-42535W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry