Mouse Anti-Gorilla USB1 Antibody (MO-AB-38788W)


Cat: MO-AB-38788W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGorilla
CloneMO38788W
SpecificityThis antibody binds to Gorilla USB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with several conserved domains, however, its exact function is not known. Mutations in this gene are associated with poikiloderma with neutropenia (PN), which shows phenotypic overlap with Rothmund-Thomson syndrome (RTS) caused by mutations in the RECQL4 gene. It is believed that this gene product interacts with RECQL4 protein via SMAD4 proteins, explaining the partial clinical overlap between PN and RTS. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product OverviewMouse Anti-Gorilla USB1 Antibody is a mouse antibody against USB1. It can be used for USB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesU6 snRNA phosphodiesterase; EC 3.1.4.-; USB1
UniProt IDG3RLS3
Protein RefseqThe length of the protein is 265 amino acids long.
The sequence is show below: MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMEAFHLSLSQSVVLRHHWILPFVQALKARMTSFQRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGSEDAEVLLRVHTEQVRCKSGNKFFSMPLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry