Mouse Anti-Hamsters USB1 Antibody (MO-AB-43510W)


Cat: MO-AB-43510W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO43510W
SpecificityThis antibody binds to Hamsters USB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with several conserved domains, however, its exact function is not known. Mutations in this gene are associated with poikiloderma with neutropenia (PN), which shows phenotypic overlap with Rothmund-Thomson syndrome (RTS) caused by mutations in the RECQL4 gene. It is believed that this gene product interacts with RECQL4 protein via SMAD4 proteins, explaining the partial clinical overlap between PN and RTS. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product OverviewMouse Anti-Hamsters USB1 Antibody is a mouse antibody against USB1. It can be used for USB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesU6 snRNA phosphodiesterase; EC 3.1.4.-; Usb1
UniProt IDG3I3J6
Protein RefseqThe length of the protein is268 amino acids long.
The sequence is show below: MSAAPLVGYSSSGSEDETEAPAAAGRSKPRSGGRRCGQNSLPTQRFPVPDSVLSMFSSTEEGPEDDSTKHGGRIRTFPHERGNWATHIYIPYEAKEEFLDLLDVLLSRAQTFVPRLVQMEEFHLSLSQSVVLRHHWILPFVQALKDHMASFQRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFDLTTFYQNPSFHVSLAWCVGDACLQLEGQCLQELQEIVDEFEDSEMLLRVLAEQVRCKSGNKFFSMPLK.
For Research Use Only | Not For Clinical Use.
Online Inquiry