AibGenesis™ Mouse Anti-gpa Antibody (MO-AB-13229R)


Cat: MO-AB-13229R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13229R Monoclonal Cattle (Bos taurus), Silkworm (Bombyx mori) WB, ELISA MO13229R 100 µg
MO-AB-69876W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69876W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Silkworm (Bombyx mori)
CloneMO13229R
SpecificityThis antibody binds to Cattle gpa.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle gpa Antibody is a mouse antibody against gpa. It can be used for gpa detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycophorin A; gpa; GYPA
UniProt IDA4PJ02
Protein RefseqThe length of the protein is 99 amino acids long.
The sequence is show below: MDRKMIFVLLLSGYIFTKPVATQTPGISDPTHLPGPRIVLQHKFSQPVMVSIIFAVIAGIVGIIVGSAGLILLLRRRNRERTSTPKTSEQPEEIEDLPQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry