AibGenesis™ Mouse Anti-GPER Antibody (CBMOAB-43898FYA)


Cat: CBMOAB-43898FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43898FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO43898FYA 100 µg
MO-AB-02201Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02201Y 100 µg
MO-AB-15497W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15497W 100 µg
MO-AB-56236W Monoclonal Marmoset WB, ELISA MO56236W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO43898FYA
SpecificityThis antibody binds to Rhesus GPER.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPER Antibody is a mouse antibody against GPER. It can be used for GPER detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesG-protein coupled estrogen receptor 1; GPER
UniProt IDH9FIL1
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: NTTSPELNLSHPLLGASLANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHEQYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRT.
For Research Use Only | Not For Clinical Use.
Online Inquiry