AibGenesis™ Mouse Anti-GPHB5 Antibody (CBMOAB-43899FYA)


Cat: CBMOAB-43899FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43899FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO43899FYA 100 µg
CBMOAB-78379FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78379FYA 100 µg
MO-AB-26088H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26088C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO43899FYA
SpecificityThis antibody binds to Rhesus GPHB5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPHB5 Antibody is a mouse antibody against GPHB5. It can be used for GPHB5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPHB5
UniProt IDF7GWQ5
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: MKLAFLFLGPMALLLLVGCGCVLGTSSGNLRTFVGCAVREFTFLAKKPGCRFGSPRMPAGVAVRPGRNPFWNPPILKPIIESVPTTRPNR.
For Research Use Only | Not For Clinical Use.
Online Inquiry