AibGenesis™ Mouse Anti-GPR12 Antibody (CBMOAB-43913FYA)
Cat: CBMOAB-43913FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-43913FYA | Monoclonal | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) | WB, ELISA | MO43913FYA | 100 µg | ||
| CBMOAB-78429FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78429FYA | 100 µg | ||
| MO-AB-02004W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO02004W | 100 µg | ||
| MO-AB-04020H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04020C | 100 µg | ||
| MO-AB-26194R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26194R | 100 µg | ||
| MO-AB-56261W | Monoclonal | Marmoset | WB, ELISA | MO56261W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) |
| Clone | MO43913FYA |
| Specificity | This antibody binds to Rhesus GPR12. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus GPR12 Antibody is a mouse antibody against GPR12. It can be used for GPR12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | G-protein coupled receptor 12; GPR12 |
| UniProt ID | H9FAQ8 |
| Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: TYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry