AibGenesis™ Mouse Anti-GPSM3 Antibody (CBMOAB-44068FYA)


Cat: CBMOAB-44068FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44068FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO44068FYA 100 µg
MO-AB-15580W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15580W 100 µg
MO-AB-26098H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26098C 100 µg
MO-AB-26218R Monoclonal Pig (Sus scrofa) WB, ELISA MO26218R 100 µg
MO-AB-56321W Monoclonal Marmoset WB, ELISA MO56321W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO44068FYA
SpecificityThis antibody binds to Rhesus GPSM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GPSM3 Antibody is a mouse antibody against GPSM3. It can be used for GPSM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPSM3
UniProt IDF7HCS4
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MEAERPQEEEDGEQTELLLDLVAEAQSRRLEEQRATFFTPQNPPSQAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC.
For Research Use Only | Not For Clinical Use.
Online Inquiry