Mouse Anti-gpt Antibody (MO-AB-48246W)


Cat: MO-AB-48246W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-48246W Monoclonal Maize (Zea mays), Cattle (Bos taurus), E. coli (Escherichia coli ), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO48246W 100 µg
CBMOAB-1082YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO1082YC 100 µg
CBMOAB-44069FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44069FYA 100 µg
MO-AB-56322W Monoclonal Marmoset WB, ELISA MO56322W 100 µg
MO-AB-13328R Monoclonal Cattle (Bos taurus) WB, ELISA MO13328R 100 µg
MO-DKB-01457W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays), Cattle (Bos taurus), E. coli (Escherichia coli ), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset
CloneMO48246W
SpecificityThis antibody binds to Maize gpt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. (From NCBI)
Product OverviewMouse Anti-Maize gpt Antibody is a mouse antibody against gpt. It can be used for gpt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlucose-6-phosphate / phosphate translocator 2; Glucose-6-phosphate / phosphate translocator 2Glucose-6-phosphate / phosphate-translocator isoform 1; Glucose-6-phosphate / phosphate translocator 2Glucose-6-phosphate / phosphate-translocator isoform 2; Glucose-6-pho疏?疐gpt; Zm.368
UniProt IDO64909
Protein RefseqThe length of the protein is387 amino acids long.
The sequence is show below: MIPSVRLSPGPAAFSGSSLRSKLPSIPSISSLKPSKYVVSSLKPLYLAPLDGPRTAELKSRRQPLEFRCSASAADDKESKTQVVPVQSEGAQRLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWATRLVEAPKTDLDFWKVLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSAEPAFSVLVSRFFLGETFPIPVYLSLLPIIGGCALAAVTELNFNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQMWAAGWQKALAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVSSIIIFHTPVRAVNALGAAIAILGTFLYSQAKA.
See other products for " GPT "
For Research Use Only | Not For Clinical Use.
Online Inquiry