Mouse Anti-gpt Antibody (MO-AB-48246W)
Cat: MO-AB-48246W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-48246W | Monoclonal | Maize (Zea mays), Cattle (Bos taurus), E. coli (Escherichia coli ), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset | WB, ELISA | MO48246W | 100 µg | ||
CBMOAB-1082YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO1082YC | 100 µg | ||
CBMOAB-44069FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44069FYA | 100 µg | ||
MO-AB-56322W | Monoclonal | Marmoset | WB, ELISA | MO56322W | 100 µg | ||
MO-AB-13328R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13328R | 100 µg | ||
MO-DKB-01457W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Maize (Zea mays), Cattle (Bos taurus), E. coli (Escherichia coli ), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Marmoset |
Clone | MO48246W |
Specificity | This antibody binds to Maize gpt. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. (From NCBI) |
Product Overview | Mouse Anti-Maize gpt Antibody is a mouse antibody against gpt. It can be used for gpt detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glucose-6-phosphate / phosphate translocator 2; Glucose-6-phosphate / phosphate translocator 2Glucose-6-phosphate / phosphate-translocator isoform 1; Glucose-6-phosphate / phosphate translocator 2Glucose-6-phosphate / phosphate-translocator isoform 2; Glucose-6-pho疏?疐gpt; Zm.368 |
UniProt ID | O64909 |
Protein Refseq | The length of the protein is387 amino acids long. The sequence is show below: MIPSVRLSPGPAAFSGSSLRSKLPSIPSISSLKPSKYVVSSLKPLYLAPLDGPRTAELKSRRQPLEFRCSASAADDKESKTQVVPVQSEGAQRLKISIYFATWWALNVIFNIYNKKVLNAFPYPWLTSTLSLACGSAMMLFSWATRLVEAPKTDLDFWKVLFPVAVAHTIGHVAATVSMSKVAVSFTHIIKSAEPAFSVLVSRFFLGETFPIPVYLSLLPIIGGCALAAVTELNFNMVGFMGAMISNLAFVFRNIFSKRGMKGKSVSGMNYYACLSIMSLVILTPFAIAMEGPQMWAAGWQKALAEVGPNVVWWIAAQSVFYHLYNQVSYMSLDQISPLTFSIGNTMKRISVIVSSIIIFHTPVRAVNALGAAIAILGTFLYSQAKA. |
See other products for " GPT "
CBMOAB-34185FYC | Mouse Anti-GPT Antibody (CBMOAB-34185FYC) |
MOFY-0622-FY153 | Rabbit Anti-GPT Antibody (MOFY-0622-FY153) |
For Research Use Only | Not For Clinical Use.
Online Inquiry