AibGenesis™ Mouse Anti-GPX6 Antibody (CBMOAB-04660HCB)
Cat: CBMOAB-04660HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-04660HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO04660HB | 100 µg | ||
| CBMOAB-34193FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO34193FC | 100 µg | ||
| CBMOAB-44074FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44074FYA | 100 µg | ||
| MO-AB-00582L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00582L | 100 µg | ||
| MO-AB-06535Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06535Y | 100 µg | ||
| MO-AB-08026W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08026W | 100 µg | ||
| MO-AB-08260Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08260Y | 100 µg | ||
| MO-AB-17263W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17263W | 100 µg | ||
| MO-AB-26109H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26109C | 100 µg | ||
| MO-AB-26223R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26223R | 100 µg | ||
| MO-AB-34859W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34859W | 100 µg | ||
| MO-AB-44937W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44937W | 100 µg | ||
| MO-AB-56328W | Monoclonal | Marmoset | WB, ELISA | MO56328W | 100 µg | ||
| MO-DKB-02011W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO04660HB |
| Specificity | This antibody binds to C. elegans GPX6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. Expression of this gene has been observed in embryos and olfactory epithelium; however, the exact function of this gene is not known. This isozyme is a selenoprotein in humans, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. The orthologs of this gene in mouse and rat (and some other species) contain a cysteine (Cys) residue in place of the Sec residue, and their corresponding mRNAs lack SECIS element. (From NCBI) |
| Product Overview | Mouse Anti-C. elegans GPX6 Antibody is a mouse antibody against GPX6. It can be used for GPX6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Glutathione peroxidase; gpx-6 |
| UniProt ID | H2KYJ6 |
| Protein Refseq | The length of the protein is 188 amino acids long. The sequence is show below: MNGRSLIFSILFVFSELKCDDTDENDQHGTIYQFQAKNIDGKMVSMEKYRDKVVLFTNVASYCGYTDSNYNAFKELDGIYREKGFRVAAFPCNQFEKQEPETEGKILDFVKSSYTYAPDMYSKIEVNGQNTHPLWKFLKKERGSSLSADIPWNFSKFLVDKNGHVVGRYSHSVNPIDLEEEISRLLNS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry