Mouse Anti-Grape rpl14 Antibody (MO-AB-39461W)


Cat: MO-AB-39461W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-39461W Monoclonal Grape (Vitis vinifera), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) WB, ELISA MO39461W 100 µg
CBMOAB-29965FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO29965FYA 100 µg
CBMOAB-56753FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56753FYA 100 µg
CBMOAB-96400FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96400FYA 100 µg
CBMOAB-09290HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO09290HB 100 µg
CBMOAB-89149FYB Monoclonal Rice (Oryza) WB, ELISA MO89149FYB 100 µg
MO-AB-70301W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70301W 100 µg
MO-AB-19481R Monoclonal Cattle (Bos taurus) WB, ELISA MO19481R 100 µg
MO-AB-28851R Monoclonal Pig (Sus scrofa) WB, ELISA MO28851R 100 µg
MO-AB-07223H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07223C 100 µg
MO-AB-30504H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30504C 100 µg
MO-AB-03847Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03847Y 100 µg
MO-DKB-01882W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio)
CloneMO39461W
SpecificityThis antibody binds to Grape rpl14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-Grape rpl14 Antibody is a mouse antibody against rpl14. It can be used for rpl14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein L14; rpl14
UniProt IDC5MTK1
Protein RefseqThe length of the protein is122 amino acids long.
The sequence is show below: MIQPQTHLNVADNSGARELMCIRIIGTSNRRYAHIGDVIVAVIKEVVPNMPLERSEVIRAVIVRTCKELKRDNGMIIRYDDNAAVIIDQEGNPKGTRIFGAIVRELRQLNFTKIVSLAPEVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry