Mouse Anti-rpl14 Antibody (MO-AB-00541W)
Cat: MO-AB-00541W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-00541W | Monoclonal | Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) | WB, ELISA | MO00541W | 100 µg | ||
| CBMOAB-29965FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO29965FYA | 100 µg | ||
| CBMOAB-56753FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56753FYA | 100 µg | ||
| CBMOAB-96400FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96400FYA | 100 µg | ||
| CBMOAB-09290HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO09290HB | 100 µg | ||
| CBMOAB-89149FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89149FYB | 100 µg | ||
| MO-AB-70301W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70301W | 100 µg | ||
| MO-AB-19481R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19481R | 100 µg | ||
| MO-AB-28851R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28851R | 100 µg | ||
| MO-AB-07223H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07223C | 100 µg | ||
| MO-AB-30504H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30504C | 100 µg | ||
| MO-AB-03847Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03847Y | 100 µg | ||
| MO-DKB-01882W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Barrel medic (Medicago truncatula), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Zebrafish (Danio rerio) |
| Clone | MO00541W |
| Specificity | This antibody binds to Barrel medic rpl14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Product Overview | Mouse Anti-Barrel medic rpl14 Antibody is a mouse antibody against rpl14. It can be used for rpl14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 50S ribosomal protein L14p; Ribosomal protein L14; rpl14; MTR_4g051390 |
| UniProt ID | G7JQB3 |
| Protein Refseq | The length of the protein is 122 amino acids long. The sequence is show below: MIQPQTYLNVADNSGARELMCIRIIGASNRRYAYIGDIVVAVIKKAVPNSSLERSEVIRAVIVRTCKELKRSNGIIIKYDDNAAVLIDKEGNPKGTRIFSAIARELRQLNFTKIVSLAPEVL. |
See other products for " rpl14 "
| MO-AB-39461W | Mouse Anti-Grape rpl14 Antibody (MO-AB-39461W) |
| MO-AB-00871H | Mouse Anti-rpl14 Antibody (MO-AB-00871H) |
| MO-AB-28591H | Mouse Anti-Rpl14 Antibody (MO-AB-28591H) |
| CBMOAB-40350FYC | Mouse Anti-RPL14 Antibody (CBMOAB-40350FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry