AibGenesis™ Mouse Anti-GRF10 Antibody (CBMOAB-22937FYB)


Cat: CBMOAB-22937FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22937FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO22937FYB 100 µg
CBMOAB-34201FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO34201FC 100 µg
MO-AB-48279W Monoclonal Maize (Zea mays) WB, ELISA MO48279W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO22937FYB
SpecificityThis antibody binds to Rice GRF10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice GRF10 Antibody is a mouse antibody against GRF10. It can be used for GRF10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGrowth-regulating factor 10; OsGRF10; Transcription activator GRF10; GRF10; Os02g0678800 LOC_Os02g45570
UniProt IDQ6EPP9
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MDEEKEADSPQPPSKLPRLSGADPNAGVVTMAAPPPPVGLGLGLGLGGDSRGERDVEASAAAAHKATALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWKSVASSSFGPHRFPSLAVMGLGNLCFDYRSSMEPDPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEASAAATPANNGGGGGIVFSPTSVLLAHGTARAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry