AibGenesis™ Mouse Anti-GRF5 Antibody (CBMOAB-22943FYB)


Cat: CBMOAB-22943FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22943FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO22943FYB 100 µg
CBMOAB-34214FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO34214FC 100 µg
MO-AB-48284W Monoclonal Maize (Zea mays) WB, ELISA MO48284W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO22943FYB
SpecificityThis antibody binds to Rice GRF5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice GRF5 Antibody is a mouse antibody against GRF5. It can be used for GRF5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGrowth-regulating factor 5; OsGRF5; Transcription activator GRF5; GRF5; Os06g0116200 LOC_Os06g02560
UniProt IDQ6AWY4
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MLSSSPSAAAPGIGGYQPQRGAAVFTAAQWAELEQQALIYKYLVAGVPVPGDLLLPIRPHSSAAATYSFANPAAAPFYHHHHHPSLSYYAYYGKKLDPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVESKTAAPAPQSQPQLSNVTTATHDTDAPLPSLTVGAKTHGLSLGGAGSSQFHVDAPSYGSKYSLGAKADVGELSFFSGASGNTRGFTIDSPTDSSWHSLPSSVPPYPMSKPRDSGLLPGAYSYSHLEPSQELGQVTIASLSQEQERRSFGGGAGGMLGNVKHENQPLRPFFDEWPGRRDSWSEMDEERSNQTSFSTTQLSISIPMPRCD.
For Research Use Only | Not For Clinical Use.
Online Inquiry