AibGenesis™ Mouse Anti-grx Antibody (MO-AB-28470W)


Cat: MO-AB-28470W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28470W Monoclonal Cucumber (Cucumis sativus), Grape (Vitis vinifera) WB, ELISA MO28470W 100 µg
MO-AB-39079W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39079W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCucumber (Cucumis sativus), Grape (Vitis vinifera)
CloneMO28470W
SpecificityThis antibody binds to Cucumber grx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cucumber grx Antibody is a mouse antibody against grx. It can be used for grx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutaredoxin-like protein; grx
UniProt IDQ8VWX6
Protein RefseqThe length of the protein is 37 amino acids long.
The sequence is show below: PMVFIGGKMFGGLEKVMAAHISGELVPALKDAGALWL.
For Research Use Only | Not For Clinical Use.
Online Inquiry