AibGenesis™ Mouse Anti-Gstd3 Antibody (CBMOAB-18274FYA)


Cat: CBMOAB-18274FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18274FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO18274FYA 100 µg
MO-AB-05901Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05901Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO18274FYA
SpecificityThis antibody binds to fruit fly Gstd3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Gstd3 Antibody is a mouse antibody against Gstd3. It can be used for Gstd3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase D3; DmGST22; EC 2.5.1.18; GstD3; gstD22
UniProt IDQ9VG97
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MVGKALGLEFNKKIINTLKGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVINQRLYFDMALMYPTLANYYYKAFTTGQFGSEEDYKKVQETFDFLNTFLEGQDYVAGDQYTVADIAILANVSNFDVVGFDISKYPNVARWYDHVKKITPGWEENWAGALDVKKRIEEKQNAAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry