AibGenesis™ Mouse Anti-GUCA1C Antibody (CBMOAB-44276FYA)


Cat: CBMOAB-44276FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44276FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO44276FYA 100 µg
CBMOAB-78946FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78946FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO44276FYA
SpecificityThis antibody binds to Rhesus GUCA1C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GUCA1C Antibody is a mouse antibody against GUCA1C. It can be used for GUCA1C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGUCA1C
UniProt IDF6RC86
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MGNGKSIAGDQRAVPTQGTHVWYRTFMTEYPSGLQTLHEFKTLLGLQGLNQKANKHVDQVYNTFDTNKDGFIDFLEFIAAVNLIVQEKMEQKLKWYFKLYDVDGNGSIDKNELLDMFVAVQALNGQQTLSPEEFTNLVFRKIDINNDGELTLEEFINGIAKDQDLLEIVYKSFDLSNVLRVICNGKQPDMEIDSSKSPDKAGLGKVKMKSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry